Tyr-α-CGRP (human) trifluoroacetate salt

H-Tyr-Ala-Cys-Asp-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asn-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH₂ trifluoroacetate salt (Disulfide bond)

Product description

Tyr-α-CGRP (human) trifluoroacetate salt,CAS:124756-98-5 from ruixi.It is a synthetic peptide.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	124756-98-5
Sequence	YACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH₂
Synonyms	[Tyr0] Calcitonin Gene Related Peptide, human, Tyr-CGRP I (human)
Molecular Formula	C₁₇₂H₂₇₆N₅₂O₅₁S₂
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document

msds of Tyr-α-CGRP (human) trifluoroacetate salt

Related Product

• biotinyl-a-cgrp-mouse-rat